PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024977.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 248aa    MW: 27967.5 Da    PI: 5.2245
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024977.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed+ l+d+++ +G g+W+ +++  g++R++k+c++rw++yl
      Pbr024977.1 14 RGPWTALEDKMLADYIQAHGEGQWSNVPKQAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding40.65.8e-1370111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       T++E++l+++++k+lG++ W++Ia +++ gRt  ++ ++w++ 
      Pbr024977.1  70 ITKDEEDLIIRLHKLLGNR-WSLIAGRIP-GRTKDEIENYWHSN 111
                      59*****************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129422.001965IPR017930Myb domain
SuperFamilySSF466892.2E-2711108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002491.7E-151461IPR001005SANT/Myb domain
CDDcd001673.26E-91661No hitNo description
Gene3DG3DSA:1.10.10.601.8E-1965115IPR009057Homeodomain-like
PROSITE profilePS5129415.41866116IPR017930Myb domain
SMARTSM007171.5E-1066114IPR001005SANT/Myb domain
PfamPF002498.5E-1270111IPR001005SANT/Myb domain
CDDcd001675.07E-971112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRNPCCSKE GVKRGPWTAL EDKMLADYIQ AHGEGQWSNV PKQAGLKRCG KSCRLRWLNY  60
LRPSIKGGDI TKDEEDLIIR LHKLLGNRWS LIAGRIPGRT KDEIENYWHS NLCKKQQEDH  120
ILSCRPSTST EIADTVQQSK VEVHLENDPS CNNNFALGSS MLCNLTDIMA EESETSSGSL  180
LSASKSREED RSSCWENILM EDFHTREMSL SEFLDTDFTK LSNVFGFRMC DVMSNEVLLE  240
GESGYGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-241411527127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334683.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLM5XNX75e-79M5XNX7_PRUPE; Uncharacterized protein
STRINGVIT_04s0008g01820.t014e-66(Vitis vinifera)
STRINGVIT_09s0002g01400.t015e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-56myb domain protein 5